RTKN monoclonal antibody (M01), clone 2E5
  • RTKN monoclonal antibody (M01), clone 2E5

RTKN monoclonal antibody (M01), clone 2E5

Ref: AB-H00006242-M01
RTKN monoclonal antibody (M01), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RTKN.
Información adicional
Size 100 ug
Gene Name RTKN
Gene Alias -
Gene Description rhotekin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RTKN (NP_149035, 451 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6242
Clone Number 2E5
Iso type IgG1 Kappa

Enviar uma mensagem


RTKN monoclonal antibody (M01), clone 2E5

RTKN monoclonal antibody (M01), clone 2E5