RTKN polyclonal antibody (A01)
  • RTKN polyclonal antibody (A01)

RTKN polyclonal antibody (A01)

Ref: AB-H00006242-A01
RTKN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RTKN.
Información adicional
Size 50 uL
Gene Name RTKN
Gene Alias -
Gene Description rhotekin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RTKN (NP_149035, 451 a.a. ~ 549 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6242

Enviar uma mensagem


RTKN polyclonal antibody (A01)

RTKN polyclonal antibody (A01)