RRM2 polyclonal antibody (A01)
  • RRM2 polyclonal antibody (A01)

RRM2 polyclonal antibody (A01)

Ref: AB-H00006241-A01
RRM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RRM2.
Información adicional
Size 50 uL
Gene Name RRM2
Gene Alias R2|RR2M
Gene Description ribonucleotide reductase M2 polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6241

Enviar uma mensagem


RRM2 polyclonal antibody (A01)

RRM2 polyclonal antibody (A01)