RRM1 monoclonal antibody (M04), clone 1D6
  • RRM1 monoclonal antibody (M04), clone 1D6

RRM1 monoclonal antibody (M04), clone 1D6

Ref: AB-H00006240-M04
RRM1 monoclonal antibody (M04), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RRM1.
Información adicional
Size 100 ug
Gene Name RRM1
Gene Alias R1|RIR1|RR1
Gene Description ribonucleotide reductase M1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRM1 (NP_001024.1, 593 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6240
Clone Number 1D6
Iso type IgG2a Kappa

Enviar uma mensagem


RRM1 monoclonal antibody (M04), clone 1D6

RRM1 monoclonal antibody (M04), clone 1D6