RRM1 polyclonal antibody (A01)
  • RRM1 polyclonal antibody (A01)

RRM1 polyclonal antibody (A01)

Ref: AB-H00006240-A01
RRM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RRM1.
Información adicional
Size 50 uL
Gene Name RRM1
Gene Alias R1|RIR1|RR1
Gene Description ribonucleotide reductase M1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRM1 (NP_001024, 644 a.a. ~ 753 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6240

Enviar uma mensagem


RRM1 polyclonal antibody (A01)

RRM1 polyclonal antibody (A01)