RRAS monoclonal antibody (M01), clone 2E12
  • RRAS monoclonal antibody (M01), clone 2E12

RRAS monoclonal antibody (M01), clone 2E12

Ref: AB-H00006237-M01
RRAS monoclonal antibody (M01), clone 2E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RRAS.
Información adicional
Size 100 ug
Gene Name RRAS
Gene Alias -
Gene Description related RAS viral (r-ras) oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq AINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRAS (AAH16286, 109 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6237
Clone Number 2E12
Iso type IgG2b Kappa

Enviar uma mensagem


RRAS monoclonal antibody (M01), clone 2E12

RRAS monoclonal antibody (M01), clone 2E12