RPS16 polyclonal antibody (A01)
  • RPS16 polyclonal antibody (A01)

RPS16 polyclonal antibody (A01)

Ref: AB-H00006217-A01
RPS16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS16.
Información adicional
Size 50 uL
Gene Name RPS16
Gene Alias -
Gene Description ribosomal protein S16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARARYQKSYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS16 (NP_001011, 48 a.a. ~ 146 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6217

Enviar uma mensagem


RPS16 polyclonal antibody (A01)

RPS16 polyclonal antibody (A01)