RPS11 monoclonal antibody (M03), clone 2A5
  • RPS11 monoclonal antibody (M03), clone 2A5

RPS11 monoclonal antibody (M03), clone 2A5

Ref: AB-H00006205-M03
RPS11 monoclonal antibody (M03), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS11.
Información adicional
Size 100 ug
Gene Name RPS11
Gene Alias -
Gene Description ribosomal protein S11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq KCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS11 (NP_001006, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6205
Clone Number 2A5
Iso type IgG2a Kappa

Enviar uma mensagem


RPS11 monoclonal antibody (M03), clone 2A5

RPS11 monoclonal antibody (M03), clone 2A5