RPS9 monoclonal antibody (M03), clone 2D3
  • RPS9 monoclonal antibody (M03), clone 2D3

RPS9 monoclonal antibody (M03), clone 2D3

Ref: AB-H00006203-M03
RPS9 monoclonal antibody (M03), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS9.
Información adicional
Size 100 ug
Gene Name RPS9
Gene Alias -
Gene Description ribosomal protein S9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS9 (AAH00802.1, 82 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6203
Clone Number 2D3
Iso type IgG2a Kappa

Enviar uma mensagem


RPS9 monoclonal antibody (M03), clone 2D3

RPS9 monoclonal antibody (M03), clone 2D3