RPS7 monoclonal antibody (M03J), clone 3G4
  • RPS7 monoclonal antibody (M03J), clone 3G4

RPS7 monoclonal antibody (M03J), clone 3G4

Ref: AB-H00006201-M03J
RPS7 monoclonal antibody (M03J), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS7.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name RPS7
Gene Alias -
Gene Description ribosomal protein S7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6201
Clone Number 3G4
Iso type IgG1 Kappa

Enviar uma mensagem


RPS7 monoclonal antibody (M03J), clone 3G4

RPS7 monoclonal antibody (M03J), clone 3G4