RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)
  • RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)

RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006197-D01P
RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPS6KA3 protein.
Información adicional
Size 100 ug
Gene Name RPS6KA3
Gene Alias CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKILGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPS6KA3 (AAH96303.1, 1 a.a. ~ 740 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6197

Enviar uma mensagem


RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)

RPS6KA3 purified MaxPab rabbit polyclonal antibody (D01P)