RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)

RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006196-D01P
RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPS6KA2 protein.
Información adicional
Size 100 ug
Gene Name RPS6KA2
Gene Alias HU-2|MAPKAPK1C|RSK|RSK3|S6K-alpha|S6K-alpha2|p90-RSK3|pp90RSK3
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPS6KA2 (NP_066958.2, 1 a.a. ~ 733 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6196

Enviar uma mensagem


RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)

RPS6KA2 purified MaxPab rabbit polyclonal antibody (D01P)