RPS3A polyclonal antibody (A01)
  • RPS3A polyclonal antibody (A01)

RPS3A polyclonal antibody (A01)

Ref: AB-H00006189-A01
RPS3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS3A.
Información adicional
Size 50 uL
Gene Name RPS3A
Gene Alias FTE1|MFTL|MGC23240
Gene Description ribosomal protein S3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS3A (NP_000997, 164 a.a. ~ 263 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6189

Enviar uma mensagem


RPS3A polyclonal antibody (A01)

RPS3A polyclonal antibody (A01)