RPS2 monoclonal antibody (M01), clone 3G6
  • RPS2 monoclonal antibody (M01), clone 3G6

RPS2 monoclonal antibody (M01), clone 3G6

Ref: AB-H00006187-M01
RPS2 monoclonal antibody (M01), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS2.
Información adicional
Size 100 ug
Gene Name RPS2
Gene Alias LLREP3|MGC102851|MGC117344|MGC117345
Gene Description ribosomal protein S2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6187
Clone Number 3G6
Iso type IgG2a Kappa

Enviar uma mensagem


RPS2 monoclonal antibody (M01), clone 3G6

RPS2 monoclonal antibody (M01), clone 3G6