MRPS12 MaxPab mouse polyclonal antibody (B01)
  • MRPS12 MaxPab mouse polyclonal antibody (B01)

MRPS12 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00006183-B01
MRPS12 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS12 protein.
Información adicional
Size 50 uL
Gene Name MRPS12
Gene Alias MPR-S12|MT-RPS12|RPMS12|RPS12|RPSM12
Gene Description mitochondrial ribosomal protein S12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS12 (NP_066930, 1 a.a. ~ 138 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6183

Enviar uma mensagem


MRPS12 MaxPab mouse polyclonal antibody (B01)

MRPS12 MaxPab mouse polyclonal antibody (B01)