RPL37A polyclonal antibody (A01)
  • RPL37A polyclonal antibody (A01)

RPL37A polyclonal antibody (A01)

Ref: AB-H00006168-A01
RPL37A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL37A.
Información adicional
Size 50 uL
Gene Name RPL37A
Gene Alias MGC74786
Gene Description ribosomal protein L37a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL37A (NP_000989, 2 a.a. ~ 50 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6168

Enviar uma mensagem


RPL37A polyclonal antibody (A01)

RPL37A polyclonal antibody (A01)