RPL34 polyclonal antibody (A01)
  • RPL34 polyclonal antibody (A01)

RPL34 polyclonal antibody (A01)

Ref: AB-H00006164-A01
RPL34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL34.
Información adicional
Size 50 uL
Gene Name RPL34
Gene Alias MGC111005
Gene Description ribosomal protein L34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL34 (NP_000986, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6164

Enviar uma mensagem


RPL34 polyclonal antibody (A01)

RPL34 polyclonal antibody (A01)