RPL27A polyclonal antibody (A01)
  • RPL27A polyclonal antibody (A01)

RPL27A polyclonal antibody (A01)

Ref: AB-H00006157-A01
RPL27A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL27A.
Información adicional
Size 50 uL
Gene Name RPL27A
Gene Alias FLJ43464|MGC10850|MGC17878|MGC87238
Gene Description ribosomal protein L27a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL27A (NP_000981, 49 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6157

Enviar uma mensagem


RPL27A polyclonal antibody (A01)

RPL27A polyclonal antibody (A01)