RPL23A monoclonal antibody (M10), clone 3E11
  • RPL23A monoclonal antibody (M10), clone 3E11

RPL23A monoclonal antibody (M10), clone 3E11

Ref: AB-H00006147-M10
RPL23A monoclonal antibody (M10), clone 3E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL23A.
Información adicional
Size 100 ug
Gene Name RPL23A
Gene Alias FLJ27455|MDA20
Gene Description ribosomal protein L23a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq KYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL23A (NP_000975.2, 59 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6147
Clone Number 3E11
Iso type IgG2a Kappa

Enviar uma mensagem


RPL23A monoclonal antibody (M10), clone 3E11

RPL23A monoclonal antibody (M10), clone 3E11