RPL19 monoclonal antibody (M01), clone 3H4
  • RPL19 monoclonal antibody (M01), clone 3H4

RPL19 monoclonal antibody (M01), clone 3H4

Ref: AB-H00006143-M01
RPL19 monoclonal antibody (M01), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL19.
Información adicional
Size 100 ug
Gene Name RPL19
Gene Alias DKFZp779D216|FLJ27452|MGC71997
Gene Description ribosomal protein L19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL19 (NP_000972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6143
Clone Number 3H4
Iso type IgG2a Lambda

Enviar uma mensagem


RPL19 monoclonal antibody (M01), clone 3H4

RPL19 monoclonal antibody (M01), clone 3H4