RPL18A monoclonal antibody (M02), clone 3B7
  • RPL18A monoclonal antibody (M02), clone 3B7

RPL18A monoclonal antibody (M02), clone 3B7

Ref: AB-H00006142-M02
RPL18A monoclonal antibody (M02), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL18A.
Información adicional
Size 100 ug
Gene Name RPL18A
Gene Alias -
Gene Description ribosomal protein L18a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq NFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL18A (NP_000971.1, 77 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6142
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


RPL18A monoclonal antibody (M02), clone 3B7

RPL18A monoclonal antibody (M02), clone 3B7