RPL18 monoclonal antibody (M01), clone 3D5
  • RPL18 monoclonal antibody (M01), clone 3D5

RPL18 monoclonal antibody (M01), clone 3D5

Ref: AB-H00006141-M01
RPL18 monoclonal antibody (M01), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL18.
Información adicional
Size 100 ug
Gene Name RPL18
Gene Alias -
Gene Description ribosomal protein L18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL18 (NP_000970, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6141
Clone Number 3D5
Iso type IgG2a Kappa

Enviar uma mensagem


RPL18 monoclonal antibody (M01), clone 3D5

RPL18 monoclonal antibody (M01), clone 3D5