RPL18 polyclonal antibody (A01)
  • RPL18 polyclonal antibody (A01)

RPL18 polyclonal antibody (A01)

Ref: AB-H00006141-A01
RPL18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL18.
Información adicional
Size 50 uL
Gene Name RPL18
Gene Alias -
Gene Description ribosomal protein L18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL18 (NP_000970, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6141

Enviar uma mensagem


RPL18 polyclonal antibody (A01)

RPL18 polyclonal antibody (A01)