RPL15 polyclonal antibody (A01)
  • RPL15 polyclonal antibody (A01)

RPL15 polyclonal antibody (A01)

Ref: AB-H00006138-A01
RPL15 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL15.
Información adicional
Size 50 uL
Gene Name RPL15
Gene Alias EC45|FLJ26304|MGC88603|RPL10|RPLY10|RPYL10
Gene Description ribosomal protein L15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL15 (NP_002939, 105 a.a. ~ 203 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6138

Enviar uma mensagem


RPL15 polyclonal antibody (A01)

RPL15 polyclonal antibody (A01)