RPL4 purified MaxPab rabbit polyclonal antibody (D01P)
  • RPL4 purified MaxPab rabbit polyclonal antibody (D01P)

RPL4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006124-D01P
RPL4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPL4 protein.
Información adicional
Size 100 ug
Gene Name RPL4
Gene Alias -
Gene Description ribosomal protein L4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce
Immunogen Prot. Seq MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPL4 (NP_000959.2, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6124

Enviar uma mensagem


RPL4 purified MaxPab rabbit polyclonal antibody (D01P)

RPL4 purified MaxPab rabbit polyclonal antibody (D01P)