RPL4 polyclonal antibody (A01)
  • RPL4 polyclonal antibody (A01)

RPL4 polyclonal antibody (A01)

Ref: AB-H00006124-A01
RPL4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL4.
Información adicional
Size 50 uL
Gene Name RPL4
Gene Alias -
Gene Description ribosomal protein L4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL4 (NP_000959, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6124

Enviar uma mensagem


RPL4 polyclonal antibody (A01)

RPL4 polyclonal antibody (A01)