RPL3L polyclonal antibody (A01)
  • RPL3L polyclonal antibody (A01)

RPL3L polyclonal antibody (A01)

Ref: AB-H00006123-A01
RPL3L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL3L.
Información adicional
Size 50 uL
Gene Name RPL3L
Gene Alias -
Gene Description ribosomal protein L3-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL3L (NP_005052, 280 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6123

Enviar uma mensagem


RPL3L polyclonal antibody (A01)

RPL3L polyclonal antibody (A01)