RP2 purified MaxPab mouse polyclonal antibody (B01P)
  • RP2 purified MaxPab mouse polyclonal antibody (B01P)

RP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006102-B01P
RP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RP2 protein.
Información adicional
Size 50 ug
Gene Name RP2
Gene Alias DELXp11.3|KIAA0215|TBCCD2
Gene Description retinitis pigmentosa 2 (X-linked recessive)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLID
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RP2 (AAH43348.1, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6102

Enviar uma mensagem


RP2 purified MaxPab mouse polyclonal antibody (B01P)

RP2 purified MaxPab mouse polyclonal antibody (B01P)