ROM1 polyclonal antibody (A02)
  • ROM1 polyclonal antibody (A02)

ROM1 polyclonal antibody (A02)

Ref: AB-H00006094-A02
ROM1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ROM1.
Información adicional
Size 50 uL
Gene Name ROM1
Gene Alias ROM|ROSP1|TSPAN23
Gene Description retinal outer segment membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROM1 (NP_000318, 163 a.a. ~ 264 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6094

Enviar uma mensagem


ROM1 polyclonal antibody (A02)

ROM1 polyclonal antibody (A02)