ROBO2 polyclonal antibody (A01)
  • ROBO2 polyclonal antibody (A01)

ROBO2 polyclonal antibody (A01)

Ref: AB-H00006092-A01
ROBO2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ROBO2.
Información adicional
Size 50 uL
Gene Name ROBO2
Gene Alias KIAA1568|SAX3
Gene Description roundabout, axon guidance receptor, homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROBO2 (NP_002933, 441 a.a. ~ 540 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6092

Enviar uma mensagem


ROBO2 polyclonal antibody (A01)

ROBO2 polyclonal antibody (A01)