ROBO1 polyclonal antibody (A01)
  • ROBO1 polyclonal antibody (A01)

ROBO1 polyclonal antibody (A01)

Ref: AB-H00006091-A01
ROBO1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ROBO1.
Información adicional
Size 50 uL
Gene Name ROBO1
Gene Alias DUTT1|FLJ21882|MGC131599|MGC133277|SAX3
Gene Description roundabout, axon guidance receptor, homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROBO1 (NP_002932, 491 a.a. ~ 589 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6091

Enviar uma mensagem


ROBO1 polyclonal antibody (A01)

ROBO1 polyclonal antibody (A01)