RNPEP polyclonal antibody (A01)
  • RNPEP polyclonal antibody (A01)

RNPEP polyclonal antibody (A01)

Ref: AB-H00006051-A01
RNPEP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNPEP.
Información adicional
Size 50 uL
Gene Name RNPEP
Gene Alias DKFZp547H084
Gene Description arginyl aminopeptidase (aminopeptidase B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNPEP (NP_064601, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6051

Enviar uma mensagem


RNPEP polyclonal antibody (A01)

RNPEP polyclonal antibody (A01)