RNH1 polyclonal antibody (A01)
  • RNH1 polyclonal antibody (A01)

RNH1 polyclonal antibody (A01)

Ref: AB-H00006050-A01
RNH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNH1.
Información adicional
Size 50 uL
Gene Name RNH1
Gene Alias MGC18200|MGC4569|MGC54054|RAI|RNH
Gene Description ribonuclease/angiogenin inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNH1 (NP_976323, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6050

Enviar uma mensagem


RNH1 polyclonal antibody (A01)

RNH1 polyclonal antibody (A01)