RNF6 polyclonal antibody (A01)
  • RNF6 polyclonal antibody (A01)

RNF6 polyclonal antibody (A01)

Ref: AB-H00006049-A01
RNF6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF6.
Información adicional
Size 50 uL
Gene Name RNF6
Gene Alias DKFZp686P0776
Gene Description ring finger protein (C3H2C3 type) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNQSRSRSDGGSEETLPQDHNHHENERRWQQERLHREEAYYQFINELNDEDYRLMRDHNLLGTPGEITSEELQQRLDGVKEQLASQPDLRDGTNYRDSEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF6 (NP_005968, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6049

Enviar uma mensagem


RNF6 polyclonal antibody (A01)

RNF6 polyclonal antibody (A01)