RNF4 polyclonal antibody (A01)
  • RNF4 polyclonal antibody (A01)

RNF4 polyclonal antibody (A01)

Ref: AB-H00006047-A01
RNF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF4.
Información adicional
Size 50 uL
Gene Name RNF4
Gene Alias RES4-26|SNURF
Gene Description ring finger protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF4 (NP_002929, 107 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6047

Enviar uma mensagem


RNF4 polyclonal antibody (A01)

RNF4 polyclonal antibody (A01)