BRD2 MaxPab rabbit polyclonal antibody (D01)
  • BRD2 MaxPab rabbit polyclonal antibody (D01)

BRD2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006046-D01
BRD2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BRD2 protein.
Información adicional
Size 100 uL
Gene Name BRD2
Gene Alias D6S113E|DKFZp686N0336|FLJ31942|FSH|FSRG1|KIAA9001|NAT|RING3|RNF3
Gene Description bromodomain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BRD2 (NP_005095.1, 1 a.a. ~ 801 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6046

Enviar uma mensagem


BRD2 MaxPab rabbit polyclonal antibody (D01)

BRD2 MaxPab rabbit polyclonal antibody (D01)