RNASEL polyclonal antibody (A01)
  • RNASEL polyclonal antibody (A01)

RNASEL polyclonal antibody (A01)

Ref: AB-H00006041-A01
RNASEL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNASEL.
Información adicional
Size 50 uL
Gene Name RNASEL
Gene Alias DKFZp781D08126|MGC104972|MGC133329|PRCA1|RNS4
Gene Description ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNASEL (NP_066956, 619 a.a. ~ 728 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6041

Enviar uma mensagem


RNASEL polyclonal antibody (A01)

RNASEL polyclonal antibody (A01)