RNASE2 polyclonal antibody (A01)
  • RNASE2 polyclonal antibody (A01)

RNASE2 polyclonal antibody (A01)

Ref: AB-H00006036-A01
RNASE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNASE2.
Información adicional
Size 50 uL
Gene Name RNASE2
Gene Alias EDN|RNS2
Gene Description ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNASE2 (NP_002925, 86 a.a. ~ 161 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6036

Enviar uma mensagem


RNASE2 polyclonal antibody (A01)

RNASE2 polyclonal antibody (A01)