RLF monoclonal antibody (M05), clone 2G2
  • RLF monoclonal antibody (M05), clone 2G2

RLF monoclonal antibody (M05), clone 2G2

Ref: AB-H00006018-M05
RLF monoclonal antibody (M05), clone 2G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RLF.
Información adicional
Size 100 ug
Gene Name RLF
Gene Alias MGC142226|ZN-15L|ZNF292L
Gene Description rearranged L-myc fusion
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6018
Clone Number 2G2
Iso type IgG2a Kappa

Enviar uma mensagem


RLF monoclonal antibody (M05), clone 2G2

RLF monoclonal antibody (M05), clone 2G2