RING1 monoclonal antibody (M07), clone 4E8
  • RING1 monoclonal antibody (M07), clone 4E8

RING1 monoclonal antibody (M07), clone 4E8

Ref: AB-H00006015-M07
RING1 monoclonal antibody (M07), clone 4E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RING1.
Información adicional
Size 100 ug
Gene Name RING1
Gene Alias RING1A|RNF1
Gene Description ring finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RING1 (NP_002922, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6015
Clone Number 4E8
Iso type IgG2b Kappa

Enviar uma mensagem


RING1 monoclonal antibody (M07), clone 4E8

RING1 monoclonal antibody (M07), clone 4E8