RLN1 purified MaxPab mouse polyclonal antibody (B01P)
  • RLN1 purified MaxPab mouse polyclonal antibody (B01P)

RLN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006013-B01P
RLN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RLN1 protein.
Información adicional
Size 50 ug
Gene Name RLN1
Gene Alias H1|RLXH1|bA12D24.3.1|bA12D24.3.2
Gene Description relaxin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RLN1 (NP_008842.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6013

Enviar uma mensagem


RLN1 purified MaxPab mouse polyclonal antibody (B01P)

RLN1 purified MaxPab mouse polyclonal antibody (B01P)