RGS13 monoclonal antibody (M10), clone 1D5
  • RGS13 monoclonal antibody (M10), clone 1D5

RGS13 monoclonal antibody (M10), clone 1D5

Ref: AB-H00006003-M10
RGS13 monoclonal antibody (M10), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RGS13.
Información adicional
Size 100 ug
Gene Name RGS13
Gene Alias MGC17173
Gene Description regulator of G-protein signaling 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS13 (AAH16667, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6003
Clone Number 1D5
Iso type IgG2a Kappa

Enviar uma mensagem


RGS13 monoclonal antibody (M10), clone 1D5

RGS13 monoclonal antibody (M10), clone 1D5