RGS13 purified MaxPab mouse polyclonal antibody (B01P)
  • RGS13 purified MaxPab mouse polyclonal antibody (B01P)

RGS13 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006003-B01P
RGS13 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RGS13 protein.
Información adicional
Size 50 ug
Gene Name RGS13
Gene Alias MGC17173
Gene Description regulator of G-protein signaling 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS13 (NP_002918.1, 1 a.a. ~ 159 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6003

Enviar uma mensagem


RGS13 purified MaxPab mouse polyclonal antibody (B01P)

RGS13 purified MaxPab mouse polyclonal antibody (B01P)