RFX5 MaxPab rabbit polyclonal antibody (D01)
  • RFX5 MaxPab rabbit polyclonal antibody (D01)

RFX5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005993-D01
RFX5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RFX5 protein.
Información adicional
Size 100 uL
Gene Name RFX5
Gene Alias -
Gene Description regulatory factor X, 5 (influences HLA class II expression)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPSGPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RFX5 (NP_000440.1, 1 a.a. ~ 616 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5993

Enviar uma mensagem


RFX5 MaxPab rabbit polyclonal antibody (D01)

RFX5 MaxPab rabbit polyclonal antibody (D01)