RFX3 purified MaxPab mouse polyclonal antibody (B01P)
  • RFX3 purified MaxPab mouse polyclonal antibody (B01P)

RFX3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005991-B01P
RFX3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RFX3 protein.
Información adicional
Size 50 ug
Gene Name RFX3
Gene Alias MGC87155|bA32F11.1
Gene Description regulatory factor X, 3 (influences HLA class II expression)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYVEGSDTVYTNGAIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGGTYLIGNSMENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RFX3 (NP_602304.1, 1 a.a. ~ 749 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5991

Enviar uma mensagem


RFX3 purified MaxPab mouse polyclonal antibody (B01P)

RFX3 purified MaxPab mouse polyclonal antibody (B01P)