RFNG polyclonal antibody (A01)
  • RFNG polyclonal antibody (A01)

RFNG polyclonal antibody (A01)

Ref: AB-H00005986-A01
RFNG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFNG.
Información adicional
Size 50 uL
Gene Name RFNG
Gene Alias -
Gene Description RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFNG (AAC51359.1, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5986

Enviar uma mensagem


RFNG polyclonal antibody (A01)

RFNG polyclonal antibody (A01)