RFC3 purified MaxPab rabbit polyclonal antibody (D01P)
  • RFC3 purified MaxPab rabbit polyclonal antibody (D01P)

RFC3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005983-D01P
RFC3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RFC3 protein.
Información adicional
Size 100 ug
Gene Name RFC3
Gene Alias MGC5276|RFC38
Gene Description replication factor C (activator 1) 3, 38kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RFC3 (NP_002906.1, 1 a.a. ~ 356 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5983

Enviar uma mensagem


RFC3 purified MaxPab rabbit polyclonal antibody (D01P)

RFC3 purified MaxPab rabbit polyclonal antibody (D01P)