RFC2 polyclonal antibody (A01)
  • RFC2 polyclonal antibody (A01)

RFC2 polyclonal antibody (A01)

Ref: AB-H00005982-A01
RFC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFC2.
Información adicional
Size 50 uL
Gene Name RFC2
Gene Alias A1|MGC3665|RFC40
Gene Description replication factor C (activator 1) 2, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFC2 (NP_852136, 245 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5982

Enviar uma mensagem


RFC2 polyclonal antibody (A01)

RFC2 polyclonal antibody (A01)