RFC1 polyclonal antibody (A01)
  • RFC1 polyclonal antibody (A01)

RFC1 polyclonal antibody (A01)

Ref: AB-H00005981-A01
RFC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFC1.
Información adicional
Size 50 uL
Gene Name RFC1
Gene Alias A1|MGC51786|MHCBFB|PO-GA|RECC1|RFC|RFC140
Gene Description replication factor C (activator 1) 1, 145kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5981

Enviar uma mensagem


RFC1 polyclonal antibody (A01)

RFC1 polyclonal antibody (A01)