RELB purified MaxPab rabbit polyclonal antibody (D01P)
  • RELB purified MaxPab rabbit polyclonal antibody (D01P)

RELB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005971-D01P
RELB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RELB protein.
Información adicional
Size 100 ug
Gene Name RELB
Gene Alias I-REL|IREL
Gene Description v-rel reticuloendotheliosis viral oncogene homolog B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RELB (NP_006500.2, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5971

Enviar uma mensagem


RELB purified MaxPab rabbit polyclonal antibody (D01P)

RELB purified MaxPab rabbit polyclonal antibody (D01P)